PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00660.1.p
Common NameEUGRSUZ_I00660, LOC104418411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 265aa    MW: 29626.5 Da    PI: 8.7554
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00660.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.3e-19115169256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Eucgr.I00660.1.p 115 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 169
                       788899***********************************************98 PP

2HD-ZIP_I/II125.52.5e-40115204191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Eucgr.I00660.1.p 115 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 204
                       69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-18101165IPR009057Homeodomain-like
SuperFamilySSF466896.27E-19105172IPR009057Homeodomain-like
PROSITE profilePS5007117.621111171IPR001356Homeobox domain
SMARTSM003891.0E-15113175IPR001356Homeobox domain
PfamPF000462.8E-16115169IPR001356Homeobox domain
CDDcd000863.28E-16115172No hitNo description
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
SMARTSM003405.7E-26171214IPR003106Leucine zipper, homeobox-associated
PfamPF021834.9E-10171205IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGIDDLCNTG LVLSLGLETP FKIEAQRQAK QRLNFEPSLT LCLSGTTKAT RDEQPPADHL  60
YRQASPHSHN SLSAVSSFSS PRVKRERDLS SEEAEVETRV SSKASDEDDD GANARKKLRL  120
TKEQSALLEE SFKQHSTLNP KQKQALARQL NLRPRQVEVW FQNRRARTKL KQTEVDCEFL  180
KKCCETLTDE NRRLQKELQE LKALKLAQPF YMHMPAATLT MCPSCERIGA GPSVDGAAPT  240
KGPFSMTTKS HLYSHHFTNP SAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163171RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00660.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028050.10.0PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466041e-100HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A059ALZ20.0A0A059ALZ2_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s14590.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.19e-90HD-ZIP family protein